Actin Regulatory Protein CAPG Antibody

Catalog number KC-1923-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1923-01

Size / count 50 μL

Specifications

Catalog number: KC-1923-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Macrophage-capping protein, Actin regulatory protein CAP-G
Gene Name: CAPG
Gene ID: 822
UniProt: P40121
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CAPG
Target: PP-1092
Partner Proteins: Macrophage-capping protein; Actin regulatory protein CAP-G
Clone: K52030_15E9
Conjugation: Unconjugated
Applications: WB
Validation: WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 93%, Rat - 95%, Pig - 95%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: RDLALAIRDSERQGKAQVEIVTDGEEPAEMIQVLGPKPALKEGNPEEDLTADKANAQAAALYKVSDATGQMNLTKVADSS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 93%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: AFCP; MCP
Target Alternative Name: Actin Regulatory Protein CAPG
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: Capping actin protein, gelsolin like
WB Description: Succeed
IP description: Fail (THP-1)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Actin Regulatory Protein CAPG Antibody?

The catalog number for Actin Regulatory Protein CAPG Antibody is KC-1923.

What sizes are available for Actin Regulatory Protein CAPG Antibody?

Actin Regulatory Protein CAPG Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Actin Regulatory Protein CAPG Antibody come in?

Actin Regulatory Protein CAPG Antibody is available in 3 different pack sizes.

Is Actin Regulatory Protein CAPG Antibody in stock?

Actin Regulatory Protein CAPG Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

All Products