Actin Regulatory Protein CAPG Antibody

Catalog number KC-1178-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1178-01

Size / count 50 μL

Specifications

Catalog number: KC-1178-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Macrophage-capping protein, Actin regulatory protein CAP-G
Gene Name: CAPG
Gene ID: 822
UniProt: P40121
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CAPG
Target: PP-1092
Partner Proteins: Macrophage-capping protein; Actin regulatory protein CAP-G
Clone: K52030_18F3
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 93%, Rat - 95%, Pig - 95%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: RDLALAIRDSERQGKAQVEIVTDGEEPAEMIQVLGPKPALKEGNPEEDLTADKANAQAAALYKVSDATGQMNLTKVADSS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 93%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: AFCP; MCP
Target Alternative Name: Actin Regulatory Protein CAPG
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: Capping actin protein, gelsolin like
IHC description: Succeed
IP description: Fail (THP-1)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Actin Regulatory Protein CAPG Antibody?

The catalog number for Actin Regulatory Protein CAPG Antibody is KC-1178.

What sizes are available for Actin Regulatory Protein CAPG Antibody?

Actin Regulatory Protein CAPG Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Actin Regulatory Protein CAPG Antibody come in?

Actin Regulatory Protein CAPG Antibody is available in 3 different pack sizes.

Is Actin Regulatory Protein CAPG Antibody in stock?

Actin Regulatory Protein CAPG Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

All Products