CCL8 Antibody (HRP)

Catalog number KH-2841-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-2841-01

Size / count 50 μL

Specifications

Catalog number: KH-2841-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: C-C motif chemokine 8, HC14, Monocyte chemoattractant protein 2, Monocyte chemotactic protein 2, MCP-2, Small-inducible cytokine A8) [Cleaved into: MCP-2 (6-76]
Gene Name: CCL8
Gene ID: 6355
UniProt: P80075
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CCL8
Target: PP-3673
Partner Proteins: C-C motif chemokine 8; HC14; Monocyte chemoattractant protein 2; Monocyte chemotactic protein 2; MCP-2; Small-inducible cytokine A8) [Cleaved into: MCP-2 (6-76]
Clone: K52037_16E3
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 58%, Rat - 58%, Pig - 72%, Cynomolgus monkey - 95%
Purity: ≥85%
Cores: QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 58%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: MCP2; SCYA10; SCYA8
Target Alternative Name: CCL8
Panel Description: Cytokines
Host or Source: Mouse
Protein Name: C-C motif chemokine ligand 8
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for CCL8 Antibody (HRP)?

The catalog number for CCL8 Antibody (HRP) is KH-2841.

What sizes are available for CCL8 Antibody (HRP)?

CCL8 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CCL8 Antibody (HRP) come in?

CCL8 Antibody (HRP) is available in 3 different pack sizes.

Is CCL8 Antibody (HRP) in stock?

CCL8 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

All Products