HIF1-beta Antibody

Catalog number KC-2123-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2123-01

Size / count 50 μL

Specifications

Catalog number: KC-2123-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Aryl hydrocarbon receptor nuclear translocator, ARNT protein, Class E basic helix-loop-helix protein 2, bHLHe2, Dioxin receptor, nuclear translocator, Hypoxia-inducible factor 1-beta, HIF-1-beta, HIF1-beta
Gene Name: ARNT
Gene ID: 405
UniProt: P27540
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ARNT
Target: PP-771
Partner Proteins: Aryl hydrocarbon receptor nuclear translocator; ARNT protein; Class E basic helix-loop-helix protein 2; bHLHe2; Dioxin receptor; nuclear translocator; Hypoxia-inducible factor 1-beta; HIF-1-beta; HIF1-beta
Clone: K52055_12C1
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 86%, Pig - 95%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: PRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSKPLEKSDGLFAQDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENF
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 84%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:50
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: BHLHE2
Target Alternative Name: HIF1-beta
Panel Description: Transcription Factors
Host or Source: Mouse
Protein Name: Aryl hydrocarbon receptor nuclear translocator
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for HIF1-beta Antibody?

The catalog number for HIF1-beta Antibody is KC-2123.

What sizes are available for HIF1-beta Antibody?

HIF1-beta Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does HIF1-beta Antibody come in?

HIF1-beta Antibody is available in 3 different pack sizes.

Is HIF1-beta Antibody in stock?

HIF1-beta Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

All Products