PKC-gamma Antibody

Catalog number KC-2708-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2708-01

Size / count 50 μL

Specifications

Catalog number: KC-2708-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Protein kinase C gamma type, PKC-gamma
Gene Name: PRKCG
Gene ID: 5582
UniProt: P05129
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PRKCG
Target: PP-10663
Partner Proteins: Protein kinase C gamma type; PKC-gamma
Clone: K52063_19A4
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 98%, Rat - 98%, Pig - 99%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: LQLEIRAPTADEIHVTVGEARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRLSVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 98%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: PKCG
Target Alternative Name: PKC-gamma
Panel Description: Neurodegenerative Diseases Marker, Ferroptosis
Host or Source: Mouse
Protein Name: Protein kinase C gamma
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for PKC-gamma Antibody?

The catalog number for PKC-gamma Antibody is KC-2708.

What sizes are available for PKC-gamma Antibody?

PKC-gamma Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does PKC-gamma Antibody come in?

PKC-gamma Antibody is available in 3 different pack sizes.

Is PKC-gamma Antibody in stock?

PKC-gamma Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

All Products