Insulin Receptor Antibody

Catalog number KC-2818-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2818-01

Size / count 50 μL

Specifications

Catalog number: KC-2818-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Insulin receptor, IR, CD antigen CD220) [Cleaved into: Insulin receptor subunit alpha, Insulin receptor subunit beta]
Gene Name: INSR
Gene ID: 3643
UniProt: P06213
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human INSR
Target Antigen: CD220
Target: P00140PAD
Partner Proteins: Insulin receptor; IR; CD antigen CD220) [Cleaved into: Insulin receptor subunit alpha; Insulin receptor subunit beta]
Clone: K56025_16G4
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 94%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSSGT
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 97%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:500~1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Insulin Receptor
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Insulin receptor
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for Insulin Receptor Antibody?

The catalog number for Insulin Receptor Antibody is KC-2818.

What sizes are available for Insulin Receptor Antibody?

Insulin Receptor Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Insulin Receptor Antibody come in?

Insulin Receptor Antibody is available in 3 different pack sizes.

Is Insulin Receptor Antibody in stock?

Insulin Receptor Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.