CD83 Antibody (HRP)

Catalog number KH-2909-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-2909-01

Size / count 50 μL

Specifications

Catalog number: KH-2909-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: CD83 antigen, hCD83, B-cell activation protein, Cell surface protein HB15, CD antigen CD83
Gene Name: CD83
Gene ID: 9308
UniProt: Q01151
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CD83
Target Antigen: CD83
Target: PP-1201
Partner Proteins: CD83 antigen; hCD83; B-cell activation protein; Cell surface protein HB15; CD antigen CD83
Clone: K70018_3H11
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 56%, Pig - 62%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: PEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 56%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: CD83
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: CD83 molecule
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for CD83 Antibody (HRP)?

The catalog number for CD83 Antibody (HRP) is KH-2909.

What sizes are available for CD83 Antibody (HRP)?

CD83 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CD83 Antibody (HRP) come in?

CD83 Antibody (HRP) is available in 3 different pack sizes.

Is CD83 Antibody (HRP) in stock?

CD83 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

All Products