CD81 Antibody (HRP)

Catalog number KH-606-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-606-01

Size / count 50 μL

Specifications

Catalog number: KH-606-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: CD81 antigen, 26 kDa cell surface protein TAPA-1, Target of the antiproliferative antibody 1, Tetraspanin-28, Tspan-28, CD antigen CD81
Gene Name: CD81
Gene ID: 975
UniProt: P60033
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CD81
Target Antigen: CD81
Target: PP-1420
Partner Proteins: CD81 antigen; 26 kDa cell surface protein TAPA-1; Target of the antiproliferative antibody 1; Tetraspanin-28; Tspan-28; CD antigen CD81
Clone: K70020_12D6
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 80%, Rat - 83%, Pig - 89%, Cynomolgus monkey - 95%
Purity: ≥85%
Cores: KDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDC
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 80%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: TAPA1; TSPAN28
Target Alternative Name: CD81
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: CD81 molecule
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for CD81 Antibody (HRP)?

The catalog number for CD81 Antibody (HRP) is KH-606.

What sizes are available for CD81 Antibody (HRP)?

CD81 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CD81 Antibody (HRP) come in?

CD81 Antibody (HRP) is available in 3 different pack sizes.

Is CD81 Antibody (HRP) in stock?

CD81 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.