Integrin alpha-2 Antibody

Catalog number KC-731-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-731-01

Size / count 50 μL

Specifications

Catalog number: KC-731-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Integrin alpha-2, CD49 antigen-like family member B, Collagen receptor, Platelet membrane glycoprotein Ia, GPIa, VLA-2 subunit alpha, CD antigen CD49b
Gene Name: ITGA2
Gene ID: 3673
UniProt: P17301
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ITGA2
Target Antigen: CD49b
Target: PP-196
Partner Proteins: Integrin alpha-2; CD49 antigen-like family member B; Collagen receptor; Platelet membrane glycoprotein Ia; GPIa; VLA-2 subunit alpha; CD antigen CD49b
Clone: K70028_5C4
Conjugation: Unconjugated
Applications: IHC&WB
Validation: IHC&WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 81%, Rat - 33%, Pig - 86%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: VTSRGLFKENNERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETAKVFSIPFHKDCG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 81%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:500
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CD49B
Target Alternative Name: Integrin alpha-2
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Integrin subunit alpha 2
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Integrin alpha-2 Antibody?

The catalog number for Integrin alpha-2 Antibody is KC-731.

What sizes are available for Integrin alpha-2 Antibody?

Integrin alpha-2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Integrin alpha-2 Antibody come in?

Integrin alpha-2 Antibody is available in 3 different pack sizes.

Is Integrin alpha-2 Antibody in stock?

Integrin alpha-2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

All Products