Integrin alpha-2 Antibody

Catalog number KC-724-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-724-01

Size / count 50 μL

Specifications

Catalog number: KC-724-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Integrin alpha-2, CD49 antigen-like family member B, Collagen receptor, Platelet membrane glycoprotein Ia, GPIa, VLA-2 subunit alpha, CD antigen CD49b
Gene Name: ITGA2
Gene ID: 3673
UniProt: P17301
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ITGA2
Target Antigen: CD49b
Target: PP-196
Partner Proteins: Integrin alpha-2; CD49 antigen-like family member B; Collagen receptor; Platelet membrane glycoprotein Ia; GPIa; VLA-2 subunit alpha; CD antigen CD49b
Clone: K70028_6G6
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 81%, Rat - 33%, Pig - 86%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: VTSRGLFKENNERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETAKVFSIPFHKDCG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 81%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CD49B
Target Alternative Name: Integrin alpha-2
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Integrin subunit alpha 2
WB Description: Succeed
IHC description: Fail (Skin)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Integrin alpha-2 Antibody?

The catalog number for Integrin alpha-2 Antibody is KC-724.

What sizes are available for Integrin alpha-2 Antibody?

Integrin alpha-2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Integrin alpha-2 Antibody come in?

Integrin alpha-2 Antibody is available in 3 different pack sizes.

Is Integrin alpha-2 Antibody in stock?

Integrin alpha-2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.