Integrin alpha-2 Antibody

Catalog number KC-732-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-732-01

Size / count 50 μL

Specifications

Catalog number: KC-732-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Integrin alpha-2, CD49 antigen-like family member B, Collagen receptor, Platelet membrane glycoprotein Ia, GPIa, VLA-2 subunit alpha, CD antigen CD49b
Gene Name: ITGA2
Gene ID: 3673
UniProt: P17301
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ITGA2
Target Antigen: CD49b
Target: PP-196
Partner Proteins: Integrin alpha-2; CD49 antigen-like family member B; Collagen receptor; Platelet membrane glycoprotein Ia; GPIa; VLA-2 subunit alpha; CD antigen CD49b
Clone: K70028_7B5
Conjugation: Unconjugated
Applications: Top_IHC&WB
Validation: Top_IHC&WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 81%, Rat - 33%, Pig - 86%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: VTSRGLFKENNERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETAKVFSIPFHKDCG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 81%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:500
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CD49B
Target Alternative Name: Integrin alpha-2
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Integrin subunit alpha 2
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Integrin alpha-2 Antibody?

The catalog number for Integrin alpha-2 Antibody is KC-732.

What sizes are available for Integrin alpha-2 Antibody?

Integrin alpha-2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Integrin alpha-2 Antibody come in?

Integrin alpha-2 Antibody is available in 3 different pack sizes.

Is Integrin alpha-2 Antibody in stock?

Integrin alpha-2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

All Products