Integrin alpha-2 Antibody — image 1 of 3

Product details

Integrin alpha-2 Antibody

Catalog number KC-733-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-733-01

Size / count 50 μL

Specifications

Catalog number: KC-733-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Integrin alpha-2, CD49 antigen-like family member B, Collagen receptor, Platelet membrane glycoprotein Ia, GPIa, VLA-2 subunit alpha, CD antigen CD49b
Gene Name: ITGA2
Gene ID: 3673
UniProt: P17301
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ITGA2
Target Antigen: CD49b
Target: PP-196
Partner Proteins: Integrin alpha-2; CD49 antigen-like family member B; Collagen receptor; Platelet membrane glycoprotein Ia; GPIa; VLA-2 subunit alpha; CD antigen CD49b
Clone: K70028_18A10
Conjugation: Unconjugated
Applications: Top_IHC&WB&ELISA
Validation: Top_IHC&WB&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 81%, Rat - 33%, Pig - 86%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: VTSRGLFKENNERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETAKVFSIPFHKDCG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 81%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:500
WB Dilution: 1:1000
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CD49B
Target Alternative Name: Integrin alpha-2
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Integrin subunit alpha 2
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Integrin alpha-2 Antibody?

The catalog number for Integrin alpha-2 Antibody is KC-733.

What sizes are available for Integrin alpha-2 Antibody?

Integrin alpha-2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Integrin alpha-2 Antibody come in?

Integrin alpha-2 Antibody is available in 3 different pack sizes.

Is Integrin alpha-2 Antibody in stock?

Integrin alpha-2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

All Products