TNFRSF10B Antibody

Catalog number KC-2033-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2033-01

Size / count 50 μL

Specifications

Catalog number: KC-2033-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Tumor necrosis factor receptor superfamily member 10B, Death receptor 5, TNF-related apoptosis-inducing ligand receptor 2, TRAIL receptor 2, TRAIL-R2, CD antigen CD262
Gene Name: TNFRSF10B
Gene ID: 8795
UniProt: O14763
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TNFRSF10B
Target Antigen: CD262
Target: PP-1216
Partner Proteins: Tumor necrosis factor receptor superfamily member 10B; Death receptor 5; TNF-related apoptosis-inducing ligand receptor 2; TRAIL receptor 2; TRAIL-R2; CD antigen CD262
Clone: K70030_15E10
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 42%, Pig - 61%, Cynomolgus monkey - 90%
Purity: ≥85%
Cores: SGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKESGTKHSGE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 42%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: DR5; KILLER; TRAILR2; TRICK2; ZTNFR9
Target Alternative Name: TNFRSF10B
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: TNF receptor superfamily member 10b
WB Description: Succeed
IP description: Fail (THP-1)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for TNFRSF10B Antibody?

The catalog number for TNFRSF10B Antibody is KC-2033.

What sizes are available for TNFRSF10B Antibody?

TNFRSF10B Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does TNFRSF10B Antibody come in?

TNFRSF10B Antibody is available in 3 different pack sizes.

Is TNFRSF10B Antibody in stock?

TNFRSF10B Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.