Product details

Dynamin-1 Antibody

Catalog number KC-1264-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1264-01

Size / count 50 μL

Specifications

Catalog number: KC-1264-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Dynamin-1
Gene Name: DNM1
Gene ID: 1759
UniProt: Q05193
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant human DNM1
Target: PP-4993
Partner Proteins: Dynamin-1
Clone: K70033_7C9
Conjugation: Unconjugated
Applications: Top_IHC&WB
Validation: Top_IHC&WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 91%
Purity: ≥85%
Cores: IRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAPPGVPSRSGQASPSRPESPRP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: DNM
Target Alternative Name: Dynamin-1
Host or Source: Mouse
Protein Name: Dynamin 1
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Dynamin-1 Antibody?

The catalog number for Dynamin-1 Antibody is KC-1264.

What sizes are available for Dynamin-1 Antibody?

Dynamin-1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Dynamin-1 Antibody come in?

Dynamin-1 Antibody is available in 3 different pack sizes.

Is Dynamin-1 Antibody in stock?

Dynamin-1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

All Products