SLURP1 Antibody (HRP)

Catalog number KH-2684-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-2684-01

Size / count 50 μL

Specifications

Catalog number: KH-2684-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Secreted Ly-6/uPAR-related protein 1, SLURP-1, ARS component B, ARS (component B) -81/S, Anti-neoplastic urinary protein, ANUP
Gene Name: SLURP1
Gene ID: 57152
UniProt: P55000
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SLURP1
Target: PQ-167
Partner Proteins: Secreted Ly-6/uPAR-related protein 1; SLURP-1; ARS component B; ARS (component B) -81/S; Anti-neoplastic urinary protein; ANUP
Clone: K70043_14A9
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 67%, Pig - 69%, Cynomolgus monkey - 88%
Purity: ≥85%
Cores: LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 67%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: ARS
Target Alternative Name: SLURP1
Host or Source: Mouse
Protein Name: Secreted LY6/PLAUR domain containing 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for SLURP1 Antibody (HRP)?

The catalog number for SLURP1 Antibody (HRP) is KH-2684.

What sizes are available for SLURP1 Antibody (HRP)?

SLURP1 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does SLURP1 Antibody (HRP) come in?

SLURP1 Antibody (HRP) is available in 3 different pack sizes.

Is SLURP1 Antibody (HRP) in stock?

SLURP1 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

All Products