TNFSF14 Antibody (HRP)

Catalog number KH-3018-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-3018-01

Size / count 50 μL

Specifications

Catalog number: KH-3018-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Tumor necrosis factor ligand superfamily member 14, Herpes virus entry mediator ligand, HVEM-L, Herpesvirus entry mediator ligand, CD antigen CD258) [Cleaved into: Tumor necrosis factor ligand superfamily member 14, membrane form, Tumor necrosis factor ligand superfamily member 14, soluble form]
Gene Name: TNFSF14
Gene ID: 8740
UniProt: O43557
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TNFSF14
Target Antigen: CD258
Target: PQ-147
Partner Proteins: Tumor necrosis factor ligand superfamily member 14; Herpes virus entry mediator ligand; HVEM-L; Herpesvirus entry mediator ligand; CD antigen CD258) [Cleaved into: Tumor necrosis factor ligand superfamily member 14; membrane form; Tumor necrosis factor ligand superfamily member 14; soluble form]
Clone: K70045_20D5
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 80%, Rat - 31%, Pig - 80%, Cynomolgus monkey - 93%
Purity: ≥85%
Cores: EQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 80%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: HVEML; LIGHT
Target Alternative Name: TNFSF14
Panel Description: Cytokines, CD Antigen
Host or Source: Mouse
Protein Name: TNF superfamily member 14
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for TNFSF14 Antibody (HRP)?

The catalog number for TNFSF14 Antibody (HRP) is KH-3018.

What sizes are available for TNFSF14 Antibody (HRP)?

TNFSF14 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does TNFSF14 Antibody (HRP) come in?

TNFSF14 Antibody (HRP) is available in 3 different pack sizes.

Is TNFSF14 Antibody (HRP) in stock?

TNFSF14 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

All Products