CD63 Antibody (HRP)

Catalog number KH-1934-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-1934-01

Size / count 50 μL

Specifications

Catalog number: KH-1934-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: CD63 antigen, Granulophysin, Lysosomal-associated membrane protein 3, LAMP-3, Lysosome integral membrane protein 1, Limp1, Melanoma-associated antigen ME491, OMA81H, Ocular melanoma-associated antigen, Tetraspanin-30, Tspan-30, CD antigen CD63, CD63 antigen, Granulophysin, Lysosomal-associated membrane protein 3, LAMP-3, Lysosome integral membrane protein 1, Limp1, Melanoma-associated antigen ME491, OMA81H, Ocular melanoma-associated antigen, Tetraspanin-30, Tspan-30, CD antigen CD63
Gene Name: CD63
UniProt: P08962-1
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CD63
Target Antigen: CD63, CD63
Target: P09869SA
Partner Proteins: CD63 antigen; Granulophysin; Lysosomal-associated membrane protein 3; LAMP-3; Lysosome integral membrane protein 1; Limp1; Melanoma-associated antigen ME491; OMA81H; Ocular melanoma-associated antigen; Tetraspanin-30; Tspan-30; CD antigen CD63
Clone: K8U003_12D9
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 67%, Rat - 66%, Pig - 78%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: VMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLR
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 67%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: MLA1; TSPAN30
Target Alternative Name: CD63
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: CD63 molecule, CD63 antigen
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for CD63 Antibody (HRP)?

The catalog number for CD63 Antibody (HRP) is KH-1934.

What sizes are available for CD63 Antibody (HRP)?

CD63 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CD63 Antibody (HRP) come in?

CD63 Antibody (HRP) is available in 3 different pack sizes.

Is CD63 Antibody (HRP) in stock?

CD63 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.