Survivin Antibody (HRP)

Catalog number KH-2988-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-2988-01

Size / count 50 μL

Specifications

Catalog number: KH-2988-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Baculoviral IAP repeat-containing protein 5, Apoptosis inhibitor 4, Apoptosis inhibitor survivin
Gene Name: BIRC5
Gene ID: 332
UniProt: O15392
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human BIRC5
Target: PP-012
Partner Proteins: Baculoviral IAP repeat-containing protein 5; Apoptosis inhibitor 4; Apoptosis inhibitor survivin
Clone: K8U009_8D1
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Rat - 85%, Pig - 95%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: AGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: API4; IAP4
Target Alternative Name: Survivin
Panel Description: IHC Pathology, Neuroscience Biomarkers
Host or Source: Mouse
Protein Name: Baculoviral IAP repeat containing 5
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Survivin Antibody (HRP)?

The catalog number for Survivin Antibody (HRP) is KH-2988.

What sizes are available for Survivin Antibody (HRP)?

Survivin Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Survivin Antibody (HRP) come in?

Survivin Antibody (HRP) is available in 3 different pack sizes.

Is Survivin Antibody (HRP) in stock?

Survivin Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

All Products