Survivin Antibody (HRP)

Catalog number KH-2998-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-2998-01

Size / count 50 μL

Specifications

Catalog number: KH-2998-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Baculoviral IAP repeat-containing protein 5, Apoptosis inhibitor 4, Apoptosis inhibitor survivin
Gene Name: BIRC5
Gene ID: 332
UniProt: O15392
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human BIRC5
Target: PP-012
Partner Proteins: Baculoviral IAP repeat-containing protein 5; Apoptosis inhibitor 4; Apoptosis inhibitor survivin
Clone: K8U009_15A8
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Rat - 85%, Pig - 95%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: AGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: API4; IAP4
Target Alternative Name: Survivin
Panel Description: IHC Pathology, Neuroscience Biomarkers
Host or Source: Mouse
Protein Name: Baculoviral IAP repeat containing 5
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Survivin Antibody (HRP)?

The catalog number for Survivin Antibody (HRP) is KH-2998.

What sizes are available for Survivin Antibody (HRP)?

Survivin Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Survivin Antibody (HRP) come in?

Survivin Antibody (HRP) is available in 3 different pack sizes.

Is Survivin Antibody (HRP) in stock?

Survivin Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.