Survivin Antibody (HRP)

Catalog number KH-3001-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-3001-01

Size / count 50 μL

Specifications

Catalog number: KH-3001-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Baculoviral IAP repeat-containing protein 5, Apoptosis inhibitor 4, Apoptosis inhibitor survivin
Gene Name: BIRC5
Gene ID: 332
UniProt: O15392
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human BIRC5
Target: PP-012
Partner Proteins: Baculoviral IAP repeat-containing protein 5; Apoptosis inhibitor 4; Apoptosis inhibitor survivin
Clone: K8U009_17C8
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Rat - 85%, Pig - 95%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: AGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: API4; IAP4
Target Alternative Name: Survivin
Panel Description: IHC Pathology, Neuroscience Biomarkers
Host or Source: Mouse
Protein Name: Baculoviral IAP repeat containing 5
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Survivin Antibody (HRP)?

The catalog number for Survivin Antibody (HRP) is KH-3001.

What sizes are available for Survivin Antibody (HRP)?

Survivin Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Survivin Antibody (HRP) come in?

Survivin Antibody (HRP) is available in 3 different pack sizes.

Is Survivin Antibody (HRP) in stock?

Survivin Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

All Products