Alpha A Crystallin Antibody

Catalog number KC-2544-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2544-01

Size / count 50 μL

Specifications

Catalog number: KC-2544-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Alpha-crystallin A chain, Heat shock protein beta-4, HspB4) [Cleaved into: Alpha-crystallin A (1-172, Alpha-crystallin A (1-168, Alpha-crystallin A (1-162]
Gene Name: CRYAA
Gene ID: 1409
UniProt: P02489
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CRYAA
Target: PP-10652
Partner Proteins: Alpha-crystallin A chain; Heat shock protein beta-4; HspB4) [Cleaved into: Alpha-crystallin A (1-172; Alpha-crystallin A (1-168; Alpha-crystallin A (1-162]
Clone: K8U013_8C11
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 84%, Pig - 92%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 84%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CRYA1; HSPB4
Target Alternative Name: Alpha A Crystallin
Host or Source: Mouse
Protein Name: Crystallin alpha A
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Alpha A Crystallin Antibody?

The catalog number for Alpha A Crystallin Antibody is KC-2544.

What sizes are available for Alpha A Crystallin Antibody?

Alpha A Crystallin Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Alpha A Crystallin Antibody come in?

Alpha A Crystallin Antibody is available in 3 different pack sizes.

Is Alpha A Crystallin Antibody in stock?

Alpha A Crystallin Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

All Products