RAGE Antibody (HRP)

Catalog number KH-2796-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-2796-01

Size / count 50 μL

Specifications

Catalog number: KH-2796-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Advanced glycosylation end product-specific receptor, Receptor for advanced glycosylation end products
Gene Name: AGER
Gene ID: 177
UniProt: Q15109
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human AGER
Target: PP-501
Partner Proteins: Advanced glycosylation end product-specific receptor; Receptor for advanced glycosylation end products
Clone: K92008_3E8
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 73%, Rat - 73%, Pig - 82%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: EPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGT
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 73%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: RAGE
Target Alternative Name: RAGE
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: Advanced glycosylation end-product specific receptor
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for RAGE Antibody (HRP)?

The catalog number for RAGE Antibody (HRP) is KH-2796.

What sizes are available for RAGE Antibody (HRP)?

RAGE Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does RAGE Antibody (HRP) come in?

RAGE Antibody (HRP) is available in 3 different pack sizes.

Is RAGE Antibody (HRP) in stock?

RAGE Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.