RAGE Antibody (HRP)

Catalog number KH-2798-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-2798-01

Size / count 50 μL

Specifications

Catalog number: KH-2798-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Advanced glycosylation end product-specific receptor, Receptor for advanced glycosylation end products
Gene Name: AGER
Gene ID: 177
UniProt: Q15109
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human AGER
Target: PP-501
Partner Proteins: Advanced glycosylation end product-specific receptor; Receptor for advanced glycosylation end products
Clone: K92008_4A4
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 73%, Rat - 73%, Pig - 82%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: EPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGT
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 73%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: RAGE
Target Alternative Name: RAGE
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: Advanced glycosylation end-product specific receptor
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for RAGE Antibody (HRP)?

The catalog number for RAGE Antibody (HRP) is KH-2798.

What sizes are available for RAGE Antibody (HRP)?

RAGE Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does RAGE Antibody (HRP) come in?

RAGE Antibody (HRP) is available in 3 different pack sizes.

Is RAGE Antibody (HRP) in stock?

RAGE Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

All Products