Progesterone Receptor Antibody

Catalog number KC-807-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-807-01

Size / count 50 μL

Specifications

Catalog number: KC-807-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Progesterone receptor, PR, Nuclear receptor subfamily 3 group C member 3
Gene Name: PGR
Gene ID: 5241
UniProt: P06401
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PGR
Target: PP-1475
Partner Proteins: Progesterone receptor; PR; Nuclear receptor subfamily 3 group C member 3
Clone: K92023_8D3
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB
Validation: Top_IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 69%, Rat - 68%, Pig - 73%, Cynomolgus monkey - 92%
Purity: ≥85%
Cores: IPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLAPSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAAAHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 69%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: NR3C3
Target Alternative Name: Progesterone Receptor
Panel Description: DNA binding & Chromatin, Transcription Factors
Host or Source: Mouse
Protein Name: Progesterone receptor
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Progesterone Receptor Antibody?

The catalog number for Progesterone Receptor Antibody is KC-807.

What sizes are available for Progesterone Receptor Antibody?

Progesterone Receptor Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Progesterone Receptor Antibody come in?

Progesterone Receptor Antibody is available in 3 different pack sizes.

Is Progesterone Receptor Antibody in stock?

Progesterone Receptor Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

All Products