Progesterone Receptor Antibody — image 1 of 3

Product details

Progesterone Receptor Antibody

Catalog number KC-1153-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1153-01

Size / count 50 μL

Specifications

Catalog number: KC-1153-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Progesterone receptor, PR, Nuclear receptor subfamily 3 group C member 3
Gene Name: PGR
Gene ID: 5241
UniProt: P06401
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PGR
Target: PP-1475
Partner Proteins: Progesterone receptor; PR; Nuclear receptor subfamily 3 group C member 3
Clone: K92023_13A8
Conjugation: Unconjugated
Applications: IHC&Top_IP/ChIP&Top_WB
Validation: IHC&Top_IP/ChIP&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 69%, Rat - 68%, Pig - 73%, Cynomolgus monkey - 92%
Purity: ≥85%
Cores: IPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLAPSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAAAHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 69%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
WB Dilution: 1:1000
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: NR3C3
Target Alternative Name: Progesterone Receptor
Panel Description: DNA binding & Chromatin, Transcription Factors
Host or Source: Mouse
Protein Name: Progesterone receptor
WB Description: Succeed
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Progesterone Receptor Antibody?

The catalog number for Progesterone Receptor Antibody is KC-1153.

What sizes are available for Progesterone Receptor Antibody?

Progesterone Receptor Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Progesterone Receptor Antibody come in?

Progesterone Receptor Antibody is available in 3 different pack sizes.

Is Progesterone Receptor Antibody in stock?

Progesterone Receptor Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.