Product details

Sulfite oxidase Antibody

Catalog number KC-2030-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2030-01

Size / count 50 μL

Specifications

Catalog number: KC-2030-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Sulfite oxidase, mitochondrial
Gene Name: SUOX
Gene ID: 6821
UniProt: P51687
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SUOX
Target: PP-5967
Partner Proteins: Sulfite oxidase; mitochondrial
Clone: K92029_3C8
Conjugation: Unconjugated
Applications: IHC&Top_IP/ChIP&Top_WB
Validation: IHC&Top_IP/ChIP&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 90%, Rat - 91%, Pig - 91%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: PVPNLDPDTYRLHVVGAPGGQSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVLAQAGHQLCETEAHVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSIQELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVH
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 90%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
WB Dilution: 1:1000
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Sulfite oxidase
Host or Source: Mouse
Protein Name: Sulfite oxidase
WB Description: Succeed
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Sulfite oxidase Antibody?

The catalog number for Sulfite oxidase Antibody is KC-2030.

What sizes are available for Sulfite oxidase Antibody?

Sulfite oxidase Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Sulfite oxidase Antibody come in?

Sulfite oxidase Antibody is available in 3 different pack sizes.

Is Sulfite oxidase Antibody in stock?

Sulfite oxidase Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.