Sulfite oxidase Antibody

Catalog number KC-1320-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1320-01

Size / count 50 μL

Specifications

Catalog number: KC-1320-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Sulfite oxidase, mitochondrial
Gene Name: SUOX
Gene ID: 6821
UniProt: P51687
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SUOX
Target: PP-5967
Partner Proteins: Sulfite oxidase; mitochondrial
Clone: K92029_4B1
Conjugation: Unconjugated
Applications: Top_IHC&Top_IP/ChIP&WB
Validation: Top_IHC&Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 90%, Rat - 91%, Pig - 91%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: PVPNLDPDTYRLHVVGAPGGQSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVLAQAGHQLCETEAHVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSIQELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVH
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 90%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
WB Dilution: 1:2000
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Sulfite oxidase
Host or Source: Mouse
Protein Name: Sulfite oxidase
WB Description: Succeed
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Sulfite oxidase Antibody?

The catalog number for Sulfite oxidase Antibody is KC-1320.

What sizes are available for Sulfite oxidase Antibody?

Sulfite oxidase Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Sulfite oxidase Antibody come in?

Sulfite oxidase Antibody is available in 3 different pack sizes.

Is Sulfite oxidase Antibody in stock?

Sulfite oxidase Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

All Products