SDF1 Antibody (HRP)

Catalog number KH-3109-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-3109-01

Size / count 50 μL

Specifications

Catalog number: KH-3109-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Stromal cell-derived factor 1, SDF-1, hSDF-1, C-X-C motif chemokine 12, Intercrine reduced in hepatomas, IRH, hIRH, Pre-B cell growth-stimulating factor, PBSF) [Cleaved into: SDF-1-beta (3-72, SDF-1-alpha (3-67]
Gene Name: CXCL12
Gene ID: 6387
UniProt: P48061
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CXCL12
Target: PP-3056
Partner Proteins: Stromal cell-derived factor 1; SDF-1; hSDF-1; C-X-C motif chemokine 12; Intercrine reduced in hepatomas; IRH; hIRH; Pre-B cell growth-stimulating factor; PBSF) [Cleaved into: SDF-1-beta (3-72; SDF-1-alpha (3-67]
Clone: K92033_9D8
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Pig - 97%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 97%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: SDF1; SDF1A; SDF1B
Target Alternative Name: SDF1
Panel Description: Cytokines
Host or Source: Mouse
Protein Name: C-X-C motif chemokine ligand 12
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for SDF1 Antibody (HRP)?

The catalog number for SDF1 Antibody (HRP) is KH-3109.

What sizes are available for SDF1 Antibody (HRP)?

SDF1 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does SDF1 Antibody (HRP) come in?

SDF1 Antibody (HRP) is available in 3 different pack sizes.

Is SDF1 Antibody (HRP) in stock?

SDF1 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

All Products