Parvalbumin Antibody

Catalog number KC-1944-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1944-01

Size / count 50 μL

Specifications

Catalog number: KC-1944-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Parvalbumin alpha
Gene Name: PVALB
Gene ID: 5816
UniProt: P20472
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PVALB
Target: PP-215
Partner Proteins: Parvalbumin alpha
Clone: K92042_16C10
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Rat - 92%, Pig - 93%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Parvalbumin
Panel Description: Neuroscience Biomarkers
Host or Source: Mouse
Protein Name: Parvalbumin
IHC description: Succeed
IP description: Fail (Rat Skeletal Muscle)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Parvalbumin Antibody?

The catalog number for Parvalbumin Antibody is KC-1944.

What sizes are available for Parvalbumin Antibody?

Parvalbumin Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Parvalbumin Antibody come in?

Parvalbumin Antibody is available in 3 different pack sizes.

Is Parvalbumin Antibody in stock?

Parvalbumin Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.