Thyroglobulin Antibody

Catalog number KC-1474-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1474-01

Size / count 50 μL

Specifications

Catalog number: KC-1474-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Thyroglobulin, Tg
Gene Name: TG
Gene ID: 7038
UniProt: P01266
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TG
Target: PP-060
Partner Proteins: Thyroglobulin; Tg
Clone: K94014_14F8
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 70%, Rat - 69%, Pig - 76%, Cynomolgus monkey - 90%
Purity: ≥85%
Cores: VTDCQRNEAGLQCDQNGQYRASQKDRGSGKAFCVDGEGRRLPWWETEAPLEDSQCLMMQKFEKVPESKVIFDANAPVAVRSKVPDSEFPVMQCLTDCTED
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 70%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Thyroglobulin
Panel Description: IHC Pathology, Autoimmune Disease
Host or Source: Mouse
Protein Name: Thyroglobulin
WB Description: Fail (HeLa)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Thyroglobulin Antibody?

The catalog number for Thyroglobulin Antibody is KC-1474.

What sizes are available for Thyroglobulin Antibody?

Thyroglobulin Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Thyroglobulin Antibody come in?

Thyroglobulin Antibody is available in 3 different pack sizes.

Is Thyroglobulin Antibody in stock?

Thyroglobulin Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

All Products