TGFA Antibody (HRP)

Catalog number KH-3013-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-3013-01

Size / count 50 μL

Specifications

Catalog number: KH-3013-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Protransforming growth factor alpha [Cleaved into: Transforming growth factor alpha, TGF-alpha, EGF-like TGF, ETGF, TGF type 1]
Gene Name: TGFA
Gene ID: 7039
UniProt: P01135
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TGFA
Target: PP-3331
Partner Proteins: Protransforming growth factor alpha [Cleaved into: Transforming growth factor alpha; TGF-alpha; EGF-like TGF; ETGF; TGF type 1]
Clone: K94022_5G8
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 92%, Rat - 92%, Pig - 96%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: SADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 92%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: TGFA
Panel Description: Cytokines
Host or Source: Mouse
Protein Name: Transforming growth factor alpha
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for TGFA Antibody (HRP)?

The catalog number for TGFA Antibody (HRP) is KH-3013.

What sizes are available for TGFA Antibody (HRP)?

TGFA Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does TGFA Antibody (HRP) come in?

TGFA Antibody (HRP) is available in 3 different pack sizes.

Is TGFA Antibody (HRP) in stock?

TGFA Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

All Products