Leptin Receptor Antibody

Catalog number KC-1665-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1665-01

Size / count 50 μL

Specifications

Catalog number: KC-1665-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Leptin receptor, LEP-R, HuB219, OB receptor, OB-R, CD antigen CD295
Gene Name: LEPR
Gene ID: 3953
UniProt: P48357
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human LEPR
Target Antigen: CD295
Target: PP-1218
Partner Proteins: Leptin receptor; LEP-R; HuB219; OB receptor; OB-R; CD antigen CD295
Clone: K94028_3G7
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 72%, Rat - 70%, Pig - 79%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: KPETFEHLFIKHTASVTCGPLLLEPETISEDISVDTSWKNKDEMMPTTVVSLLSTTDLEKGSVCISDQFNSVNFSEAEGTEVTYEDESQR
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 72%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: DB; OBR
Target Alternative Name: Leptin Receptor
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Leptin receptor
IHC description: Succeed
IP description: Fail (SH-SY5Y)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for Leptin Receptor Antibody?

The catalog number for Leptin Receptor Antibody is KC-1665.

What sizes are available for Leptin Receptor Antibody?

Leptin Receptor Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Leptin Receptor Antibody come in?

Leptin Receptor Antibody is available in 3 different pack sizes.

Is Leptin Receptor Antibody in stock?

Leptin Receptor Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

All Products