Leptin Receptor Antibody

Catalog number KC-1837-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1837-01

Size / count 50 μL

Specifications

Catalog number: KC-1837-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Leptin receptor, LEP-R, HuB219, OB receptor, OB-R, CD antigen CD295
Gene Name: LEPR
Gene ID: 3953
UniProt: P48357
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human LEPR
Target Antigen: CD295
Target: PP-1218
Partner Proteins: Leptin receptor; LEP-R; HuB219; OB receptor; OB-R; CD antigen CD295
Clone: K94028_14B5
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 72%, Rat - 70%, Pig - 79%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: KPETFEHLFIKHTASVTCGPLLLEPETISEDISVDTSWKNKDEMMPTTVVSLLSTTDLEKGSVCISDQFNSVNFSEAEGTEVTYEDESQR
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 72%
Recombinant Antibody: Not recombinant
WB Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: DB; OBR
Target Alternative Name: Leptin Receptor
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Leptin receptor
WB Description: Succeed
IHC description: Fail (Mouse Brain (Choroid Plexus) )
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Leptin Receptor Antibody?

The catalog number for Leptin Receptor Antibody is KC-1837.

What sizes are available for Leptin Receptor Antibody?

Leptin Receptor Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Leptin Receptor Antibody come in?

Leptin Receptor Antibody is available in 3 different pack sizes.

Is Leptin Receptor Antibody in stock?

Leptin Receptor Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

All Products