Annexin A10 Antibody

Catalog number KC-1304-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1304-01

Size / count 50 μL

Specifications

Catalog number: KC-1304-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Annexin A10, Annexin-10, Annexin-14
Gene Name: ANXA10
Gene ID: 11199
UniProt: Q9UJ72
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ANXA10
Target: PP-1584
Partner Proteins: Annexin A10; Annexin-10; Annexin-14
Clone: K94033_1D12
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 89%, Rat - 45%, Pig - 89%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: SMYGRDLIGDMREQLSDHFKDVMAGLMYPPPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNKSYQQLRLVFQEFQNISGQDMVDAINECYDGYFQELLVAIVLCVRDKPAYFAYRLYSAIHDFGFHNKTVIRILIARSEIDLLTIRKRYKERYGKSLFHDIRNFASGHYK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 89%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: ANX14
Target Alternative Name: Annexin A10
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: Annexin A10
WB Description: Fail (A-431)
IHC description: Succeed
IP description: Fail (A-431)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Annexin A10 Antibody?

The catalog number for Annexin A10 Antibody is KC-1304.

What sizes are available for Annexin A10 Antibody?

Annexin A10 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Annexin A10 Antibody come in?

Annexin A10 Antibody is available in 3 different pack sizes.

Is Annexin A10 Antibody in stock?

Annexin A10 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

All Products