Annexin A10 Antibody

Catalog number KC-1854-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1854-01

Size / count 50 μL

Specifications

Catalog number: KC-1854-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Annexin A10, Annexin-10, Annexin-14
Gene Name: ANXA10
Gene ID: 11199
UniProt: Q9UJ72
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ANXA10
Target: PP-1584
Partner Proteins: Annexin A10; Annexin-10; Annexin-14
Clone: K94033_8E3
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB
Validation: Top_IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 89%, Rat - 45%, Pig - 89%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: SMYGRDLIGDMREQLSDHFKDVMAGLMYPPPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNKSYQQLRLVFQEFQNISGQDMVDAINECYDGYFQELLVAIVLCVRDKPAYFAYRLYSAIHDFGFHNKTVIRILIARSEIDLLTIRKRYKERYGKSLFHDIRNFASGHYK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 89%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: ANX14
Target Alternative Name: Annexin A10
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: Annexin A10
WB Description: Succeed
IHC description: Succeed
IP description: Fail (A-431)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Annexin A10 Antibody?

The catalog number for Annexin A10 Antibody is KC-1854.

What sizes are available for Annexin A10 Antibody?

Annexin A10 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Annexin A10 Antibody come in?

Annexin A10 Antibody is available in 3 different pack sizes.

Is Annexin A10 Antibody in stock?

Annexin A10 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

All Products