Product details

Annexin A10 Antibody

Catalog number KC-1907-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1907-01

Size / count 50 μL

Specifications

Catalog number: KC-1907-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Annexin A10, Annexin-10, Annexin-14
Gene Name: ANXA10
Gene ID: 11199
UniProt: Q9UJ72
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ANXA10
Target: PP-1584
Partner Proteins: Annexin A10; Annexin-10; Annexin-14
Clone: K94033_12H4
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB
Validation: Top_IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 89%, Rat - 45%, Pig - 89%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: SMYGRDLIGDMREQLSDHFKDVMAGLMYPPPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNKSYQQLRLVFQEFQNISGQDMVDAINECYDGYFQELLVAIVLCVRDKPAYFAYRLYSAIHDFGFHNKTVIRILIARSEIDLLTIRKRYKERYGKSLFHDIRNFASGHYK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 89%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: ANX14
Target Alternative Name: Annexin A10
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: Annexin A10
WB Description: Succeed
IHC description: Succeed
IP description: Fail (A-431)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Annexin A10 Antibody?

The catalog number for Annexin A10 Antibody is KC-1907.

What sizes are available for Annexin A10 Antibody?

Annexin A10 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Annexin A10 Antibody come in?

Annexin A10 Antibody is available in 3 different pack sizes.

Is Annexin A10 Antibody in stock?

Annexin A10 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

All Products