Annexin A10 Antibody

Catalog number KC-1306-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1306-01

Size / count 50 μL

Specifications

Catalog number: KC-1306-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Annexin A10, Annexin-10, Annexin-14
Gene Name: ANXA10
Gene ID: 11199
UniProt: Q9UJ72
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ANXA10
Target: PP-1584
Partner Proteins: Annexin A10; Annexin-10; Annexin-14
Clone: K94033_19B2
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 89%, Rat - 45%, Pig - 89%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: SMYGRDLIGDMREQLSDHFKDVMAGLMYPPPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNKSYQQLRLVFQEFQNISGQDMVDAINECYDGYFQELLVAIVLCVRDKPAYFAYRLYSAIHDFGFHNKTVIRILIARSEIDLLTIRKRYKERYGKSLFHDIRNFASGHYK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 89%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: ANX14
Target Alternative Name: Annexin A10
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: Annexin A10
WB Description: Fail (A-431)
IHC description: Succeed
IP description: Fail (A-431)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Annexin A10 Antibody?

The catalog number for Annexin A10 Antibody is KC-1306.

What sizes are available for Annexin A10 Antibody?

Annexin A10 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Annexin A10 Antibody come in?

Annexin A10 Antibody is available in 3 different pack sizes.

Is Annexin A10 Antibody in stock?

Annexin A10 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

All Products