Methionine Aminopeptidase 2 Antibody

Catalog number KC-3185-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-3185-01

Size / count 50 μL

Specifications

Catalog number: KC-3185-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Methionine aminopeptidase 2, MAP 2, MetAP 2, Initiation factor 2-associated 67 kDa glycoprotein, p67, p67eIF2, Peptidase M
Gene Name: METAP2
Gene ID: 10988
UniProt: P50579
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human METAP2
Target: PP-307
Partner Proteins: Methionine aminopeptidase 2; MAP 2; MetAP 2; Initiation factor 2-associated 67 kDa glycoprotein; p67; p67eIF2; Peptidase M
Clone: K94055_2B2
Conjugation: Unconjugated
Applications: Top_IP/ChIP&ELISA
Validation: Top_IP/ChIP&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 92%, Rat - 92%, Pig - 93%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: AGEQEPDKESGASVDEVARQLERSALEDKERDEDDEDGDGDGDGATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGRTAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVRKYVMSWIKPG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 92%
Recombinant Antibody: Not recombinant
IP Dilution: 1:100
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: MNPEP; P67EIF2
Target Alternative Name: Methionine Aminopeptidase 2
Host or Source: Mouse
Protein Name: Methionyl aminopeptidase 2
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Methionine Aminopeptidase 2 Antibody?

The catalog number for Methionine Aminopeptidase 2 Antibody is KC-3185.

What sizes are available for Methionine Aminopeptidase 2 Antibody?

Methionine Aminopeptidase 2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Methionine Aminopeptidase 2 Antibody come in?

Methionine Aminopeptidase 2 Antibody is available in 3 different pack sizes.

Is Methionine Aminopeptidase 2 Antibody in stock?

Methionine Aminopeptidase 2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

All Products