Wilms Tumor Protein Antibody

Catalog number KC-3022-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-3022-01

Size / count 50 μL

Specifications

Catalog number: KC-3022-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Wilms tumor protein, WT33
Gene Name: WT1
Gene ID: 7490
UniProt: P19544
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human WT1
Target: PP-10499
Partner Proteins: Wilms tumor protein; WT33
Clone: K9N020_6E11
Conjugation: Unconjugated
Applications: Top_IP/ChIP
Validation: Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 98%, Rat - 98%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: APYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 98%
Recombinant Antibody: Not recombinant
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Wilms Tumor Protein
Panel Description: IHC Pathology, Neurodegenerative Diseases Marker, Transcription Factors
Host or Source: Mouse
Protein Name: WT1 transcription factor
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for Wilms Tumor Protein Antibody?

The catalog number for Wilms Tumor Protein Antibody is KC-3022.

What sizes are available for Wilms Tumor Protein Antibody?

Wilms Tumor Protein Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Wilms Tumor Protein Antibody come in?

Wilms Tumor Protein Antibody is available in 3 different pack sizes.

Is Wilms Tumor Protein Antibody in stock?

Wilms Tumor Protein Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.