Prolactin Antibody

Catalog number KC-1035-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1035-01

Size / count 50 μL

Specifications

Catalog number: KC-1035-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Prolactin, PRL
Gene Name: PRL
Gene ID: 5617
UniProt: P01236
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PRL
Target: PP-059
Partner Proteins: Prolactin; PRL
Clone: KAA114_11E11
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 60%, Rat - 62%, Pig - 77%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: LATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 60%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Prolactin
Panel Description: IHC Pathology
Host or Source: Mouse
Protein Name: Prolactin
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for Prolactin Antibody?

The catalog number for Prolactin Antibody is KC-1035.

What sizes are available for Prolactin Antibody?

Prolactin Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Prolactin Antibody come in?

Prolactin Antibody is available in 3 different pack sizes.

Is Prolactin Antibody in stock?

Prolactin Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

All Products