Prolactin Antibody

Catalog number KC-2862-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2862-01

Size / count 50 μL

Specifications

Catalog number: KC-2862-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Prolactin, PRL
Gene Name: PRL
Gene ID: 5617
UniProt: P01236
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PRL
Target: PP-059
Partner Proteins: Prolactin; PRL
Clone: KAA114_12E5
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 60%, Rat - 62%, Pig - 77%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: LATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 60%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Prolactin
Panel Description: IHC Pathology
Host or Source: Mouse
Protein Name: Prolactin
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Prolactin Antibody?

The catalog number for Prolactin Antibody is KC-2862.

What sizes are available for Prolactin Antibody?

Prolactin Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Prolactin Antibody come in?

Prolactin Antibody is available in 3 different pack sizes.

Is Prolactin Antibody in stock?

Prolactin Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

All Products