Transcription Factor E3 Antibody

Catalog number KC-2537-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2537-01

Size / count 50 μL

Specifications

Catalog number: KC-2537-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Transcription factor E3, Class E basic helix-loop-helix protein 33, bHLHe33
Gene Name: TFE3
Gene ID: 7030
UniProt: P19532
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TFE3
Target: P61542PCGN
Partner Proteins: Transcription factor E3; Class E basic helix-loop-helix protein 33; bHLHe33
Clone: KAA382_17E2
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 92%, Rat - 63%, Pig - 96%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: SRQRSLEQANRSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 92%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: BHLHE33
Target Alternative Name: Transcription Factor E3
Panel Description: IHC Pathology, Transcription Factors
Host or Source: Mouse
Protein Name: Transcription factor binding to IGHM enhancer 3
WB Description: Fail (HT-29, HeLa, Jurkat, NIH/3T3)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Transcription Factor E3 Antibody?

The catalog number for Transcription Factor E3 Antibody is KC-2537.

What sizes are available for Transcription Factor E3 Antibody?

Transcription Factor E3 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Transcription Factor E3 Antibody come in?

Transcription Factor E3 Antibody is available in 3 different pack sizes.

Is Transcription Factor E3 Antibody in stock?

Transcription Factor E3 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.