Cardiac Troponin C Antibody

Catalog number KC-2135-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2135-01

Size / count 50 μL

Specifications

Catalog number: KC-2135-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Troponin C, slow skeletal and cardiac muscles, TN-C
Gene Name: TNNC1
Gene ID: 7134
UniProt: P63316
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TNNC1
Target: PP-4454
Partner Proteins: Troponin C; slow skeletal and cardiac muscles; TN-C
Clone: KAA461_3C10
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 51%, Pig - 99%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: TNNC
Target Alternative Name: Cardiac Troponin C
Host or Source: Mouse
Protein Name: Troponin C1, slow skeletal and cardiac type
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Cardiac Troponin C Antibody?

The catalog number for Cardiac Troponin C Antibody is KC-2135.

What sizes are available for Cardiac Troponin C Antibody?

Cardiac Troponin C Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Cardiac Troponin C Antibody come in?

Cardiac Troponin C Antibody is available in 3 different pack sizes.

Is Cardiac Troponin C Antibody in stock?

Cardiac Troponin C Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

All Products