Cardiac Troponin C Antibody

Catalog number KC-2755-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2755-01

Size / count 50 μL

Specifications

Catalog number: KC-2755-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Troponin C, slow skeletal and cardiac muscles, TN-C
Gene Name: TNNC1
Gene ID: 7134
UniProt: P63316
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TNNC1
Target: PP-4454
Partner Proteins: Troponin C; slow skeletal and cardiac muscles; TN-C
Clone: KAA461_7E10
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 51%, Pig - 99%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: TNNC
Target Alternative Name: Cardiac Troponin C
Host or Source: Mouse
Protein Name: Troponin C1, slow skeletal and cardiac type
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Cardiac Troponin C Antibody?

The catalog number for Cardiac Troponin C Antibody is KC-2755.

What sizes are available for Cardiac Troponin C Antibody?

Cardiac Troponin C Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Cardiac Troponin C Antibody come in?

Cardiac Troponin C Antibody is available in 3 different pack sizes.

Is Cardiac Troponin C Antibody in stock?

Cardiac Troponin C Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

All Products