Cardiac Troponin C Antibody

Catalog number KC-2388-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2388-01

Size / count 50 μL

Specifications

Catalog number: KC-2388-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Troponin C, slow skeletal and cardiac muscles, TN-C
Gene Name: TNNC1
Gene ID: 7134
UniProt: P63316
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TNNC1
Target: PP-4454
Partner Proteins: Troponin C; slow skeletal and cardiac muscles; TN-C
Clone: KAA461_12A2
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 51%, Pig - 99%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: TNNC
Target Alternative Name: Cardiac Troponin C
Host or Source: Mouse
Protein Name: Troponin C1, slow skeletal and cardiac type
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Cardiac Troponin C Antibody?

The catalog number for Cardiac Troponin C Antibody is KC-2388.

What sizes are available for Cardiac Troponin C Antibody?

Cardiac Troponin C Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Cardiac Troponin C Antibody come in?

Cardiac Troponin C Antibody is available in 3 different pack sizes.

Is Cardiac Troponin C Antibody in stock?

Cardiac Troponin C Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

All Products