Cardiac Troponin C Antibody

Catalog number KC-2387-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2387-01

Size / count 50 μL

Specifications

Catalog number: KC-2387-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Troponin C, slow skeletal and cardiac muscles, TN-C
Gene Name: TNNC1
Gene ID: 7134
UniProt: P63316
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TNNC1
Target: PP-4454
Partner Proteins: Troponin C; slow skeletal and cardiac muscles; TN-C
Clone: KAA461_20A5
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 51%, Pig - 99%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: TNNC
Target Alternative Name: Cardiac Troponin C
Host or Source: Mouse
Protein Name: Troponin C1, slow skeletal and cardiac type
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Cardiac Troponin C Antibody?

The catalog number for Cardiac Troponin C Antibody is KC-2387.

What sizes are available for Cardiac Troponin C Antibody?

Cardiac Troponin C Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Cardiac Troponin C Antibody come in?

Cardiac Troponin C Antibody is available in 3 different pack sizes.

Is Cardiac Troponin C Antibody in stock?

Cardiac Troponin C Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.