Recombinant C8orf34 Antibody

Catalog number RN-019-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-019-01

Size / count 50 μL

Specifications

Catalog number: RN-019-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Uncharacterized protein C8orf34, Protein VEST-1
Gene Name: C8orf34
Gene ID: 116328
UniProt: Q49A92
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human C8orf34
Target: PP-9462
Partner Proteins: Uncharacterized protein C8orf34; Protein VEST-1
Clone: K8U017_1F9
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Pig - 91%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: KWNWRTKPQSRDFDELNHILQESKKLGKALENLSRSIAISDELDKETVTFNSSLLRPRVIGEWIGREENDADPLAAEMLQPPIPRSKNDQWESEDSGSSPAGSLKMEPKNKGLKQQQQQHKKLLAAMLSQDSFESIHSPTPSVTEEDIDN
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 94%
Recombinant Antibody: Yes
IHC Dilution: 1:50
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: C8orf34
Host or Source: Mouse
Protein Name: Chromosome 8 open reading frame 34
WB Description: Fail (T-47D)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant C8orf34 Antibody?

The catalog number for Recombinant C8orf34 Antibody is RN-019.

What sizes are available for Recombinant C8orf34 Antibody?

Recombinant C8orf34 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant C8orf34 Antibody come in?

Recombinant C8orf34 Antibody is available in 3 different pack sizes.

Is Recombinant C8orf34 Antibody in stock?

Recombinant C8orf34 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.