Recombinant PHF12 Antibody

Catalog number RN-009-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-009-01

Size / count 50 μL

Specifications

Catalog number: RN-009-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: PHD finger protein 12, PHD factor 1, Pf1
Gene Name: PHF12
Gene ID: 57649
UniProt: Q96QT6
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PHF12
Target: PP-10058
Partner Proteins: PHD finger protein 12; PHD factor 1; Pf1
Clone: K8U017_20C4
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Pig - 99%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: RSASKTELKAIAHARILERRASRPGTPTSSASTETPTSEQNDVDEDIIDVDEEPVAAEPDYVQPQLRRPFELLIAAAMERNPTQFQLPNELTCTTALPGSSKRRRKEETTGKNVKKTQHELDHNGLVPLP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 97%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: KIAA1523
Target Alternative Name: PHF12
Host or Source: Mouse
Protein Name: PHD finger protein 12
IHC description: Succeed
IP description: Fail (HeLa)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant PHF12 Antibody?

The catalog number for Recombinant PHF12 Antibody is RN-009.

What sizes are available for Recombinant PHF12 Antibody?

Recombinant PHF12 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant PHF12 Antibody come in?

Recombinant PHF12 Antibody is available in 3 different pack sizes.

Is Recombinant PHF12 Antibody in stock?

Recombinant PHF12 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

All Products