Recombinant WNT7A Antibody — image 1 of 2

Product details

Recombinant WNT7A Antibody

Catalog number RN-018-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-018-01

Size / count 50 μL

Specifications

Catalog number: RN-018-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Protein Wnt-7a
Gene Name: WNT7A
Gene ID: 7476
UniProt: O00755
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant human WNT7A
Target: PP-1565
Partner Proteins: Protein Wnt-7a
Clone: K8U018_3H2
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB
Validation: Top_IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Rat - 42%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: KYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQASGCDLMCCG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: WNT7A
Panel Description: Cytokines
Host or Source: Mouse
Protein Name: Wnt family member 7A
WB Description: Succeed
IHC description: Succeed
IP description: Fail (Mouse Testis)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant WNT7A Antibody?

The catalog number for Recombinant WNT7A Antibody is RN-018.

What sizes are available for Recombinant WNT7A Antibody?

Recombinant WNT7A Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant WNT7A Antibody come in?

Recombinant WNT7A Antibody is available in 3 different pack sizes.

Is Recombinant WNT7A Antibody in stock?

Recombinant WNT7A Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.