Recombinant PLXDC1 Antibody

Catalog number RN-040-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-040-01

Size / count 50 μL

Specifications

Catalog number: RN-040-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Plexin domain-containing protein 1, Tumor endothelial marker 3, Tumor endothelial marker 7
Gene Name: PLXDC1
Gene ID: 57125
UniProt: Q8IUK5
Antigen Species: Human
Reactivity: Human, Rat
Cross Reactivity: Not tested
Immunogen: Recombinant human PLXDC1
Target: PP-1351
Partner Proteins: Plexin domain-containing protein 1; Tumor endothelial marker 3; Tumor endothelial marker 7
Clone: K9N025_3D5
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 80%, Pig - 78%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: EWMDYGCAQEAEGRMCEDFQDEDHDSASPDTSFSPYDGDLTTTSSSLFIDSLTTEDDTKLNPYAGGDGLQNNLSPKTKGT
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 80%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: TEM3; TEM7
Target Alternative Name: PLXDC1
Host or Source: Mouse
Protein Name: Plexin domain containing 1
WB Description: Succeed
IP description: Fail (Rat Liver)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant PLXDC1 Antibody?

The catalog number for Recombinant PLXDC1 Antibody is RN-040.

What sizes are available for Recombinant PLXDC1 Antibody?

Recombinant PLXDC1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant PLXDC1 Antibody come in?

Recombinant PLXDC1 Antibody is available in 3 different pack sizes.

Is Recombinant PLXDC1 Antibody in stock?

Recombinant PLXDC1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

All Products